Anti ARFGAP1 pAb (ATL-HPA051019 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051019-25

• 
• 
• 

Protein Description: ADP-ribosylation factor GTPase activating protein 1
Gene Name: ARFGAP1
Alternative Gene Name: ARF1GAP, bA261N11.3, FLJ10767
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027575: 69%, ENSRNOG00000043150: 67%
Entrez Gene ID: 55738
Uniprot ID: Q8N6T3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWTCADTSTERRSSDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWD
• Gene Sequence: DHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWTCADTSTERRSSDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWD
• Gene ID - Mouse: ENSMUSG00000027575
• Gene ID - Rat: ENSRNOG00000043150
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARFGAP1 pAb (ATL-HPA051019 w/enhanced validation) – 1 Found

Nacke, Marisa; Sandilands, Emma; Nikolatou, Konstantina; Román-Fernández, Álvaro; Mason, Susan; Patel, Rachana; Lilla, Sergio; Yelland, Tamas; Galbraith, Laura C A; Freckmann, Eva C; McGarry, Lynn; Morton, Jennifer P; Shanks, Emma; Leung, Hing Y; Markert, Elke; Ismail, Shehab; Zanivan, Sara; Blyth, Karen; Bryant, David M. An ARF GTPase module promoting invasion and metastasis through regulating phosphoinositide metabolism. Nature Communications. 2021;12(1):1623.