Anti AQR pAb (ATL-HPA055647)

Atlas Antibodies

SKU: ATL-HPA055647-25

• 

Protein Description: aquarius intron-binding spliceosomal factor
Gene Name: AQR
Alternative Gene Name: fSAP164, IBP160, KIAA0560
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040383: 98%, ENSRNOG00000008912: 98%
Entrez Gene ID: 9716
Uniprot ID: O60306
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEWEGLRKHDVCFLITVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGMLDDKGRVIEDGPEPRPNLRGESRTFRVFLDPNQYQQDMTNTIQNGAEDVYETFNI
• Gene Sequence: DEWEGLRKHDVCFLITVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGMLDDKGRVIEDGPEPRPNLRGESRTFRVFLDPNQYQQDMTNTIQNGAEDVYETFNI
• Gene ID - Mouse: ENSMUSG00000040383
• Gene ID - Rat: ENSRNOG00000008912
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.