Anti APP pAb (ATL-HPA001462 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001462-25

• 
• 

Protein Description: amyloid beta (A4) precursor protein
Gene Name: APP
Alternative Gene Name: AD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022892: 95%, ENSRNOG00000006997: 95%
Entrez Gene ID: 351
Uniprot ID: P05067
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAKDVGSN
• Gene Sequence: ANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAKDVGSN
• Gene ID - Mouse: ENSMUSG00000022892
• Gene ID - Rat: ENSRNOG00000006997
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti APP pAb (ATL-HPA001462 w/enhanced validation) – 2 Found

Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17. 

Oi, Ryoko; Koizumi, Hirotaka; Maeda, Ichiro; Noguchi, Akira; Tatsunami, Shinobu; Iwatani, Tsuguo; Kawamoto, Hisanori; Tsugawa, Koichiro; Takagi, Masayuki. Clinicopathological Significance of TARBP2, APP, and ZNF395 in Breast Cancer. Breast Cancer : Basic And Clinical Research. 10( 27980417):211-221.