Anti APOM pAb (ATL-HPA051006)

Atlas Antibodies

SKU:
ATL-HPA051006-100
  • Immunohistochemical staining of human small intestine shows positivity in plasma.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to the Golgi apparatus.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: apolipoprotein M
Gene Name: APOM
Alternative Gene Name: ApoM, G3a, NG20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024391: 80%, ENSRNOG00000000850: 81%
Entrez Gene ID: 55937
Uniprot ID: O95445
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMK
Gene Sequence LNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMK
Gene ID - Mouse ENSMUSG00000024391
Gene ID - Rat ENSRNOG00000000850
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti APOM pAb (ATL-HPA051006)
Datasheet Anti APOM pAb (ATL-HPA051006) Datasheet (External Link)
Vendor Page Anti APOM pAb (ATL-HPA051006) at Atlas Antibodies

Documents & Links for Anti APOM pAb (ATL-HPA051006)
Datasheet Anti APOM pAb (ATL-HPA051006) Datasheet (External Link)
Vendor Page Anti APOM pAb (ATL-HPA051006)