Anti APOC1 pAb (ATL-HPA051518)

Atlas Antibodies

SKU: ATL-HPA051518-25

• 

Protein Description: apolipoprotein C-I
Gene Name: APOC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040564: 65%, ENSRNOG00000051439: 65%
Entrez Gene ID: 341
Uniprot ID: P02654
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKE
• Gene Sequence: PDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKE
• Gene ID - Mouse: ENSMUSG00000040564
• Gene ID - Rat: ENSRNOG00000051439
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti APOC1 pAb (ATL-HPA051518) – 2 Found

Evangelou, Petros; Groll, Mathias; Oppermann, Henry; Gaunitz, Frank; Eisenlöffel, Christian; Müller, Wolf; Eschrich, Klaus; Schänzer, Anne; Nestler, Ulf. Assessment of ApoC1, LuzP6, C12orf75 and OCC-1 in cystic glioblastoma using MALDI-TOF mass spectrometry, immunohistochemistry and qRT-PCR. Medical Molecular Morphology. 2019;52(4):217-225. 

Lind, Anne-Li; Just, David; Mikus, Maria; Fredolini, Claudia; Ioannou, Marina; Gerdle, Björn; Ghafouri, Bijar; Bäckryd, Emmanuel; Tanum, Lars; Gordh, Torsten; Månberg, Anna. CSF levels of apolipoprotein C1 and autotaxin found to associate with neuropathic pain and fibromyalgia. Journal Of Pain Research. 12( 31686904):2875-2889.