Anti APOA1 pAb (ATL-HPA046715)
Atlas Antibodies
- SKU:
- ATL-HPA046715-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: APOA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032083: 75%, ENSRNOG00000045679: 61%
Entrez Gene ID: 335
Uniprot ID: P02647
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKL |
Gene Sequence | SKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKL |
Gene ID - Mouse | ENSMUSG00000032083 |
Gene ID - Rat | ENSRNOG00000045679 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti APOA1 pAb (ATL-HPA046715) | |
Datasheet | Anti APOA1 pAb (ATL-HPA046715) Datasheet (External Link) |
Vendor Page | Anti APOA1 pAb (ATL-HPA046715) at Atlas Antibodies |
Documents & Links for Anti APOA1 pAb (ATL-HPA046715) | |
Datasheet | Anti APOA1 pAb (ATL-HPA046715) Datasheet (External Link) |
Vendor Page | Anti APOA1 pAb (ATL-HPA046715) |
Citations for Anti APOA1 pAb (ATL-HPA046715) – 2 Found |
Bergström, Sofia; Öijerstedt, Linn; Remnestål, Julia; Olofsson, Jennie; Ullgren, Abbe; Seelaar, Harro; van Swieten, John C; Synofzik, Matthis; Sanchez-Valle, Raquel; Moreno, Fermin; Finger, Elizabeth; Masellis, Mario; Tartaglia, Carmela; Vandenberghe, Rik; Laforce, Robert; Galimberti, Daniela; Borroni, Barbara; Butler, Chris R; Gerhard, Alexander; Ducharme, Simon; Rohrer, Jonathan D; Månberg, Anna; Graff, Caroline; Nilsson, Peter. A panel of CSF proteins separates genetic frontotemporal dementia from presymptomatic mutation carriers: a GENFI study. Molecular Neurodegeneration. 2021;16(1):79. PubMed |
Lind, Anne-Li; Just, David; Mikus, Maria; Fredolini, Claudia; Ioannou, Marina; Gerdle, Björn; Ghafouri, Bijar; Bäckryd, Emmanuel; Tanum, Lars; Gordh, Torsten; Månberg, Anna. CSF levels of apolipoprotein C1 and autotaxin found to associate with neuropathic pain and fibromyalgia. Journal Of Pain Research. 12( 31686904):2875-2889. PubMed |