Anti APCS pAb (ATL-HPA053294)

Atlas Antibodies

SKU: ATL-HPA053294-100

• 
• 

Protein Description: amyloid P component, serum
Gene Name: APCS
Alternative Gene Name: MGC88159, PTX2, SAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026542: 67%, ENSRNOG00000009086: 71%
Entrez Gene ID: 325
Uniprot ID: P02743
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV
• Gene Sequence: QEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV
• Gene ID - Mouse: ENSMUSG00000026542
• Gene ID - Rat: ENSRNOG00000009086
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.