Protein Description: adenomatosis polyposis coli 2
Gene Name: APC2
Alternative Gene Name: APCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020135: 67%, ENSRNOG00000033791: 77%
Entrez Gene ID: 10297
Uniprot ID: O95996
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: APC2
Alternative Gene Name: APCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020135: 67%, ENSRNOG00000033791: 77%
Entrez Gene ID: 10297
Uniprot ID: O95996
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GQLSLLGSDVDGPSLAKAPISAPFVHEGLGVAVGGFPASRHGSPSRSARVPPFNYVPSPMVVAATTDSAAEK |
| Documents & Links for Anti APC2 pAb (ATL-HPA078002) | |
| Datasheet | Anti APC2 pAb (ATL-HPA078002) Datasheet (External Link) |
| Vendor Page | Anti APC2 pAb (ATL-HPA078002) at Atlas |
| Documents & Links for Anti APC2 pAb (ATL-HPA078002) | |
| Datasheet | Anti APC2 pAb (ATL-HPA078002) Datasheet (External Link) |
| Vendor Page | Anti APC2 pAb (ATL-HPA078002) |