Anti APC2 pAb (ATL-HPA078002)

Catalog No:
ATL-HPA078002-25
$447.00
Protein Description: adenomatosis polyposis coli 2
Gene Name: APC2
Alternative Gene Name: APCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020135: 67%, ENSRNOG00000033791: 77%
Entrez Gene ID: 10297
Uniprot ID: O95996
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence GQLSLLGSDVDGPSLAKAPISAPFVHEGLGVAVGGFPASRHGSPSRSARVPPFNYVPSPMVVAATTDSAAEK
Gene ID - Mouse ENSMUSG00000020135
Gene ID - Rat ENSMUSG00000020135
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti APC2 pAb (ATL-HPA078002)
Datasheet Anti APC2 pAb (ATL-HPA078002) Datasheet (External Link)
Vendor Page Anti APC2 pAb (ATL-HPA078002) at Atlas

Documents & Links for Anti APC2 pAb (ATL-HPA078002)
Datasheet Anti APC2 pAb (ATL-HPA078002) Datasheet (External Link)
Vendor Page Anti APC2 pAb (ATL-HPA078002)