Protein Description: amyloid beta precursor protein binding family A member 2
Gene Name: APBA2
Alternative Gene Name: D15S1518E, HsT16821, LIN-10, MGC:14091, MINT2, X11L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030519: 83%, ENSRNOG00000016358: 80%
Entrez Gene ID: 321
Uniprot ID: Q99767
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: APBA2
Alternative Gene Name: D15S1518E, HsT16821, LIN-10, MGC:14091, MINT2, X11L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030519: 83%, ENSRNOG00000016358: 80%
Entrez Gene ID: 321
Uniprot ID: Q99767
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AHRKLESVGSGMLDHRVRPGPVPHSQEPESEDMELPLEGYVPEGLELAALRPESPAPEEQECHNHSPDGDSSSDYVNNTSE |
Documents & Links for Anti APBA2 pAb (ATL-HPA070376) | |
Datasheet | Anti APBA2 pAb (ATL-HPA070376) Datasheet (External Link) |
Vendor Page | Anti APBA2 pAb (ATL-HPA070376) at Atlas |
Documents & Links for Anti APBA2 pAb (ATL-HPA070376) | |
Datasheet | Anti APBA2 pAb (ATL-HPA070376) Datasheet (External Link) |
Vendor Page | Anti APBA2 pAb (ATL-HPA070376) |