Anti AP3S2 pAb (ATL-HPA049270)
Atlas Antibodies
- SKU:
- ATL-HPA049270-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: AP3S2
Alternative Gene Name: sigma3b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063801: 100%, ENSRNOG00000043141: 100%
Entrez Gene ID: 10239
Uniprot ID: P59780
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGL |
Gene Sequence | LDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGL |
Gene ID - Mouse | ENSMUSG00000063801 |
Gene ID - Rat | ENSRNOG00000043141 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AP3S2 pAb (ATL-HPA049270) | |
Datasheet | Anti AP3S2 pAb (ATL-HPA049270) Datasheet (External Link) |
Vendor Page | Anti AP3S2 pAb (ATL-HPA049270) at Atlas Antibodies |
Documents & Links for Anti AP3S2 pAb (ATL-HPA049270) | |
Datasheet | Anti AP3S2 pAb (ATL-HPA049270) Datasheet (External Link) |
Vendor Page | Anti AP3S2 pAb (ATL-HPA049270) |