Anti AP3S2 pAb (ATL-HPA049270)

Atlas Antibodies

SKU: ATL-HPA049270-25

• 
• 

Protein Description: adaptor-related protein complex 3, sigma 2 subunit
Gene Name: AP3S2
Alternative Gene Name: sigma3b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063801: 100%, ENSRNOG00000043141: 100%
Entrez Gene ID: 10239
Uniprot ID: P59780
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGL
• Gene Sequence: LDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGL
• Gene ID - Mouse: ENSMUSG00000063801
• Gene ID - Rat: ENSRNOG00000043141
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.