Protein Description: adaptor-related protein complex 3, delta 1 subunit
Gene Name: AP3D1
Alternative Gene Name: ADTD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020198: 93%, ENSRNOG00000018977: 93%
Entrez Gene ID: 8943
Uniprot ID: O14617
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AP3D1
Alternative Gene Name: ADTD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020198: 93%, ENSRNOG00000018977: 93%
Entrez Gene ID: 8943
Uniprot ID: O14617
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IRVKAIRKFAVSQMSALLDSAHLLASSTQRNGICEVLYAAAWICGEFSEHLQEPHHTLEAMLRPRVTTLPGHIQAVYVQNVVKLYASILQQKEQAG |
| Documents & Links for Anti AP3D1 pAb (ATL-HPA074408) | |
| Datasheet | Anti AP3D1 pAb (ATL-HPA074408) Datasheet (External Link) |
| Vendor Page | Anti AP3D1 pAb (ATL-HPA074408) at Atlas |
| Documents & Links for Anti AP3D1 pAb (ATL-HPA074408) | |
| Datasheet | Anti AP3D1 pAb (ATL-HPA074408) Datasheet (External Link) |
| Vendor Page | Anti AP3D1 pAb (ATL-HPA074408) |