Anti AP3D1 pAb (ATL-HPA074408)

Atlas Antibodies

SKU:
ATL-HPA074408-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: adaptor-related protein complex 3, delta 1 subunit
Gene Name: AP3D1
Alternative Gene Name: ADTD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020198: 93%, ENSRNOG00000018977: 93%
Entrez Gene ID: 8943
Uniprot ID: O14617
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRVKAIRKFAVSQMSALLDSAHLLASSTQRNGICEVLYAAAWICGEFSEHLQEPHHTLEAMLRPRVTTLPGHIQAVYVQNVVKLYASILQQKEQAG
Gene Sequence IRVKAIRKFAVSQMSALLDSAHLLASSTQRNGICEVLYAAAWICGEFSEHLQEPHHTLEAMLRPRVTTLPGHIQAVYVQNVVKLYASILQQKEQAG
Gene ID - Mouse ENSMUSG00000020198
Gene ID - Rat ENSRNOG00000018977
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AP3D1 pAb (ATL-HPA074408)
Datasheet Anti AP3D1 pAb (ATL-HPA074408) Datasheet (External Link)
Vendor Page Anti AP3D1 pAb (ATL-HPA074408) at Atlas Antibodies

Documents & Links for Anti AP3D1 pAb (ATL-HPA074408)
Datasheet Anti AP3D1 pAb (ATL-HPA074408) Datasheet (External Link)
Vendor Page Anti AP3D1 pAb (ATL-HPA074408)