Anti ANXA8 pAb (ATL-HPA047451)

Atlas Antibodies

SKU:
ATL-HPA047451-25
  • Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: annexin A8
Gene Name: ANXA8
Alternative Gene Name: ANX8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021950: 86%, ENSRNOG00000060949: 86%
Entrez Gene ID: 653145
Uniprot ID: P13928
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAWWKSWIEQEGVTVKSSSHFNPDPDAETLYQAMK
Gene Sequence MAWWKSWIEQEGVTVKSSSHFNPDPDAETLYQAMK
Gene ID - Mouse ENSMUSG00000021950
Gene ID - Rat ENSRNOG00000060949
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANXA8 pAb (ATL-HPA047451)
Datasheet Anti ANXA8 pAb (ATL-HPA047451) Datasheet (External Link)
Vendor Page Anti ANXA8 pAb (ATL-HPA047451) at Atlas Antibodies

Documents & Links for Anti ANXA8 pAb (ATL-HPA047451)
Datasheet Anti ANXA8 pAb (ATL-HPA047451) Datasheet (External Link)
Vendor Page Anti ANXA8 pAb (ATL-HPA047451)