Anti ANO8 pAb (ATL-HPA049206)

Atlas Antibodies

SKU: ATL-HPA049206-25

• 

Protein Description: anoctamin 8
Gene Name: ANO8
Alternative Gene Name: KIAA1623, TMEM16H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034863: 53%, ENSRNOG00000052236: 27%
Entrez Gene ID: 57719
Uniprot ID: Q9HCE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REHDSGGREEARAEGSGLDPATSSEKASAKAKGSTAGGHGPERPKRPGSLLAPNNVMKLKQIIPLQGKFLSSGAT
• Gene Sequence: REHDSGGREEARAEGSGLDPATSSEKASAKAKGSTAGGHGPERPKRPGSLLAPNNVMKLKQIIPLQGKFLSSGAT
• Gene ID - Mouse: ENSMUSG00000034863
• Gene ID - Rat: ENSRNOG00000052236
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ANO8 pAb (ATL-HPA049206) – 1 Found

Klee, Katharina M C; Hess, Michael W; Lohmüller, Michael; Herzog, Sebastian; Pfaller, Kristian; Müller, Thomas; Vogel, Georg F; Huber, Lukas A. A CRISPR screen in intestinal epithelial cells identifies novel factors for polarity and apical transport. Elife. 2023;12( 36661306)