Anti ANO2 pAb (ATL-HPA057499)

Atlas Antibodies

SKU:
ATL-HPA057499-25
  • Immunohistochemical staining of human retina shows weak to moderate membranous positivity in the outer plexiform layer.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: anoctamin 2
Gene Name: ANO2
Alternative Gene Name: C12orf3, TMEM16B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038115: 84%, ENSRNOG00000023561: 85%
Entrez Gene ID: 57101
Uniprot ID: Q9NQ90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPVSLEARLSRMHFHDSQRKVDYVLAYHYRKRGVHLAQGFPGHSLAIVSNGETGKEPHAGGPGDIELGPLDALEEERKEQREEFEHNLM
Gene Sequence EPVSLEARLSRMHFHDSQRKVDYVLAYHYRKRGVHLAQGFPGHSLAIVSNGETGKEPHAGGPGDIELGPLDALEEERKEQREEFEHNLM
Gene ID - Mouse ENSMUSG00000038115
Gene ID - Rat ENSRNOG00000023561
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANO2 pAb (ATL-HPA057499)
Datasheet Anti ANO2 pAb (ATL-HPA057499) Datasheet (External Link)
Vendor Page Anti ANO2 pAb (ATL-HPA057499) at Atlas Antibodies

Documents & Links for Anti ANO2 pAb (ATL-HPA057499)
Datasheet Anti ANO2 pAb (ATL-HPA057499) Datasheet (External Link)
Vendor Page Anti ANO2 pAb (ATL-HPA057499)