Anti ANO10 pAb (ATL-HPA051569)

Atlas Antibodies

SKU: ATL-HPA051569-25

• 

Protein Description: anoctamin 10
Gene Name: ANO10
Alternative Gene Name: FLJ10375, MGC47890, SCAR10, TMEM16K
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037949: 84%, ENSRNOG00000000219: 84%
Entrez Gene ID: 55129
Uniprot ID: Q9NW15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYEQVILEKEMGTYLGTFDDYLEL
• Gene Sequence: ATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYEQVILEKEMGTYLGTFDDYLEL
• Gene ID - Mouse: ENSMUSG00000037949
• Gene ID - Rat: ENSRNOG00000000219
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ANO10 pAb (ATL-HPA051569) – 1 Found

Bushell, Simon R; Pike, Ashley C W; Falzone, Maria E; Rorsman, Nils J G; Ta, Chau M; Corey, Robin A; Newport, Thomas D; Christianson, John C; Scofano, Lara F; Shintre, Chitra A; Tessitore, Annamaria; Chu, Amy; Wang, Qinrui; Shrestha, Leela; Mukhopadhyay, Shubhashish M M; Love, James D; Burgess-Brown, Nicola A; Sitsapesan, Rebecca; Stansfeld, Phillip J; Huiskonen, Juha T; Tammaro, Paolo; Accardi, Alessio; Carpenter, Elisabeth P. The structural basis of lipid scrambling and inactivation in the endoplasmic reticulum scramblase TMEM16K. Nature Communications. 2019;10(1):3956.