Anti ANO1 pAb (ATL-HPA057356 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA057356-25

• 

Protein Description: anoctamin 1
Gene Name: ANO1
Alternative Gene Name: DOG1, FLJ10261, ORAOV2, TAOS2, TMEM16A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031075: 61%, ENSRNOG00000020865: 61%
Entrez Gene ID: 55107
Uniprot ID: Q5XXA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVEVFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYH
• Gene Sequence: MVEVFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYH
• Gene ID - Mouse: ENSMUSG00000031075
• Gene ID - Rat: ENSRNOG00000020865
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.