Anti ANKUB1 pAb (ATL-HPA053749)

Atlas Antibodies

Catalog No.:
ATL-HPA053749-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and ubiquitin domain containing 1
Gene Name: ANKUB1
Alternative Gene Name: C3orf16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074591: 83%, ENSRNOG00000043466: 80%
Entrez Gene ID: 389161
Uniprot ID: A6NFN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPFDVSADETVEVVKLMIKDYFHIPLSEDKQGRRYLELMYAGAALKDSWSLADVGISFCSTLKCFVKEEDKPTLYVFNAVTQ
Gene Sequence EPFDVSADETVEVVKLMIKDYFHIPLSEDKQGRRYLELMYAGAALKDSWSLADVGISFCSTLKCFVKEEDKPTLYVFNAVTQ
Gene ID - Mouse ENSMUSG00000074591
Gene ID - Rat ENSRNOG00000043466
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANKUB1 pAb (ATL-HPA053749)
Datasheet Anti ANKUB1 pAb (ATL-HPA053749) Datasheet (External Link)
Vendor Page Anti ANKUB1 pAb (ATL-HPA053749) at Atlas Antibodies

Documents & Links for Anti ANKUB1 pAb (ATL-HPA053749)
Datasheet Anti ANKUB1 pAb (ATL-HPA053749) Datasheet (External Link)
Vendor Page Anti ANKUB1 pAb (ATL-HPA053749)