Anti ANKRD49 pAb (ATL-HPA048137)

Atlas Antibodies

SKU: ATL-HPA048137-25

• 

Protein Description: ankyrin repeat domain 49
Gene Name: ANKRD49
Alternative Gene Name: FGIF, FLJ20189, GBIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031931: 84%, ENSRNOG00000009233: 78%
Entrez Gene ID: 54851
Uniprot ID: Q8WVL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNEEWYRLQEKKMEKDPSRLLLWAAE
• Gene Sequence: KGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNEEWYRLQEKKMEKDPSRLLLWAAE
• Gene ID - Mouse: ENSMUSG00000031931
• Gene ID - Rat: ENSRNOG00000009233
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.