Anti ANKRD33B pAb (ATL-HPA056974)
Atlas Antibodies
- SKU:
- ATL-HPA056974-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ANKRD33B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022237: 79%, ENSRNOG00000010888: 82%
Entrez Gene ID: 651746
Uniprot ID: A6NCL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TALMKAAMQGRTDCIRALMLAGADVHARDPRRGMSPQEWATYTGRVDAVRLMQRLLERPCPEQFWEKYRPE |
Gene Sequence | TALMKAAMQGRTDCIRALMLAGADVHARDPRRGMSPQEWATYTGRVDAVRLMQRLLERPCPEQFWEKYRPE |
Gene ID - Mouse | ENSMUSG00000022237 |
Gene ID - Rat | ENSRNOG00000010888 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ANKRD33B pAb (ATL-HPA056974) | |
Datasheet | Anti ANKRD33B pAb (ATL-HPA056974) Datasheet (External Link) |
Vendor Page | Anti ANKRD33B pAb (ATL-HPA056974) at Atlas Antibodies |
Documents & Links for Anti ANKRD33B pAb (ATL-HPA056974) | |
Datasheet | Anti ANKRD33B pAb (ATL-HPA056974) Datasheet (External Link) |
Vendor Page | Anti ANKRD33B pAb (ATL-HPA056974) |