Anti ANKRD33B pAb (ATL-HPA056974)

Atlas Antibodies

SKU:
ATL-HPA056974-25
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line HeLa shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 33B
Gene Name: ANKRD33B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022237: 79%, ENSRNOG00000010888: 82%
Entrez Gene ID: 651746
Uniprot ID: A6NCL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TALMKAAMQGRTDCIRALMLAGADVHARDPRRGMSPQEWATYTGRVDAVRLMQRLLERPCPEQFWEKYRPE
Gene Sequence TALMKAAMQGRTDCIRALMLAGADVHARDPRRGMSPQEWATYTGRVDAVRLMQRLLERPCPEQFWEKYRPE
Gene ID - Mouse ENSMUSG00000022237
Gene ID - Rat ENSRNOG00000010888
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANKRD33B pAb (ATL-HPA056974)
Datasheet Anti ANKRD33B pAb (ATL-HPA056974) Datasheet (External Link)
Vendor Page Anti ANKRD33B pAb (ATL-HPA056974) at Atlas Antibodies

Documents & Links for Anti ANKRD33B pAb (ATL-HPA056974)
Datasheet Anti ANKRD33B pAb (ATL-HPA056974) Datasheet (External Link)
Vendor Page Anti ANKRD33B pAb (ATL-HPA056974)