Protein Description: ankyrin repeat domain 17
Gene Name: ANKRD17
Alternative Gene Name: FLJ22206, GTAR, KIAA0697, MASK2, NY-BR-16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055204: 98%, ENSRNOG00000002940: 96%
Entrez Gene ID: 26057
Uniprot ID: O75179
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ANKRD17
Alternative Gene Name: FLJ22206, GTAR, KIAA0697, MASK2, NY-BR-16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055204: 98%, ENSRNOG00000002940: 96%
Entrez Gene ID: 26057
Uniprot ID: O75179
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KEIDELIPKNRLKSSSANSKIGSSAPTTTAANTSLMGIKMTTVALSSTSQTATALTVPAISSASTHKTIKNPVNNVRPGFPVSLP |
| Documents & Links for Anti ANKRD17 pAb (ATL-HPA063731) | |
| Datasheet | Anti ANKRD17 pAb (ATL-HPA063731) Datasheet (External Link) |
| Vendor Page | Anti ANKRD17 pAb (ATL-HPA063731) at Atlas |
| Documents & Links for Anti ANKRD17 pAb (ATL-HPA063731) | |
| Datasheet | Anti ANKRD17 pAb (ATL-HPA063731) Datasheet (External Link) |
| Vendor Page | Anti ANKRD17 pAb (ATL-HPA063731) |