Anti ANKRD17 pAb (ATL-HPA045024)

Atlas Antibodies

SKU: ATL-HPA045024-25

• 

Protein Description: ankyrin repeat domain 17
Gene Name: ANKRD17
Alternative Gene Name: FLJ22206, GTAR, KIAA0697, NY-BR-16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055204: 85%, ENSRNOG00000002940: 86%
Entrez Gene ID: 26057
Uniprot ID: O75179
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSSGSSSAHSNQQQPPGSVSQEPRPPLQQSQVPPPEVRMTVPPLATSSAPVAVPSTAPVTYPMPQTPMGCPQPTPKMETPAIRPPPHGTTAPHKN
• Gene Sequence: SSSGSSSAHSNQQQPPGSVSQEPRPPLQQSQVPPPEVRMTVPPLATSSAPVAVPSTAPVTYPMPQTPMGCPQPTPKMETPAIRPPPHGTTAPHKN
• Gene ID - Mouse: ENSMUSG00000055204
• Gene ID - Rat: ENSRNOG00000002940
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.