Anti ANKMY1 pAb (ATL-HPA048869)

Atlas Antibodies

SKU: ATL-HPA048869-25

• 

Protein Description: ankyrin repeat and MYND domain containing 1
Gene Name: ANKMY1
Alternative Gene Name: FLJ20499, ZMYND13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034212: 68%, ENSRNOG00000048567: 65%
Entrez Gene ID: 51281
Uniprot ID: Q9P2S6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PFHTLMPAERETFLARKRLLEYMGLQLRQAVFAKESQWDPTWLYLCKRAELIPSHRMKKKGPSLPRGLDVKEQGQIPFFKFCYQCGRSIGVRLLPCPRCYGILTCSKYCKTKAWTEFHKKDCGDLVAIVTQLEQVSRRREE
• Gene Sequence: PFHTLMPAERETFLARKRLLEYMGLQLRQAVFAKESQWDPTWLYLCKRAELIPSHRMKKKGPSLPRGLDVKEQGQIPFFKFCYQCGRSIGVRLLPCPRCYGILTCSKYCKTKAWTEFHKKDCGDLVAIVTQLEQVSRRREE
• Gene ID - Mouse: ENSMUSG00000034212
• Gene ID - Rat: ENSRNOG00000048567
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.