Anti ANKFY1 pAb (ATL-HPA065849)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065849-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ANKFY1
Alternative Gene Name: ANKHZN, BTBD23, KIAA1255, RANK-5, ZFYVE14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020790: 95%, ENSRNOG00000016212: 96%
Entrez Gene ID: 51479
Uniprot ID: Q9P2R3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ICTRGADMSVPDEKGNPPLWLALANNLEDIASTLVRHGCDATCWGPGPGGCLQTLLHRAIDENNEPTACFLIRSGCDVNSPR |
Gene Sequence | ICTRGADMSVPDEKGNPPLWLALANNLEDIASTLVRHGCDATCWGPGPGGCLQTLLHRAIDENNEPTACFLIRSGCDVNSPR |
Gene ID - Mouse | ENSMUSG00000020790 |
Gene ID - Rat | ENSRNOG00000016212 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ANKFY1 pAb (ATL-HPA065849) | |
Datasheet | Anti ANKFY1 pAb (ATL-HPA065849) Datasheet (External Link) |
Vendor Page | Anti ANKFY1 pAb (ATL-HPA065849) at Atlas Antibodies |
Documents & Links for Anti ANKFY1 pAb (ATL-HPA065849) | |
Datasheet | Anti ANKFY1 pAb (ATL-HPA065849) Datasheet (External Link) |
Vendor Page | Anti ANKFY1 pAb (ATL-HPA065849) |