Anti ANKFN1 pAb (ATL-HPA048953)

Atlas Antibodies

SKU: ATL-HPA048953-25

• 

Protein Description: ankyrin repeat and fibronectin type III domain containing 1
Gene Name: ANKFN1
Alternative Gene Name: FLJ38335
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047773: 76%, ENSRNOG00000023532: 74%
Entrez Gene ID: 162282
Uniprot ID: Q8N957
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKPGKHPHHGGFSRHHRWLRIHSETQSLSLSEGIYTQHLSQACGLAQEPKEAKRAGPALDDPRGLTLAHAASLPEERNSSLQDARPSVRRLYVEPYA
• Gene Sequence: RKPGKHPHHGGFSRHHRWLRIHSETQSLSLSEGIYTQHLSQACGLAQEPKEAKRAGPALDDPRGLTLAHAASLPEERNSSLQDARPSVRRLYVEPYA
• Gene ID - Mouse: ENSMUSG00000047773
• Gene ID - Rat: ENSRNOG00000023532
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.