Anti ANK1 pAb (ATL-HPA056953)

Atlas Antibodies

SKU: ATL-HPA056953-25

• 
• 

Protein Description: ankyrin 1, erythrocytic
Gene Name: ANK1
Alternative Gene Name: ANK, SPH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031543: 90%, ENSRNOG00000018241: 83%
Entrez Gene ID: 286
Uniprot ID: P16157
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSP
• Gene Sequence: FVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSP
• Gene ID - Mouse: ENSMUSG00000031543
• Gene ID - Rat: ENSRNOG00000018241
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ANK1 pAb (ATL-HPA056953) – 1 Found

Hall, A E; Lu, W-T; Godfrey, J D; Antonov, A V; Paicu, C; Moxon, S; Dalmay, T; Wilczynska, A; Muller, P A J; Bushell, M. The cytoskeleton adaptor protein ankyrin-1 is upregulated by p53 following DNA damage and alters cell migration. Cell Death & Disease. 2016;7(4):e2184.