Protein Description: anaphase promoting complex subunit 2
Gene Name: ANAPC2
Alternative Gene Name: APC2, KIAA1406
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026965: 95%, ENSRNOG00000011295: 95%
Entrez Gene ID: 29882
Uniprot ID: Q9UJX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ANAPC2
Alternative Gene Name: APC2, KIAA1406
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026965: 95%, ENSRNOG00000011295: 95%
Entrez Gene ID: 29882
Uniprot ID: Q9UJX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | REEVHTMLRGVLFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCR |
| Documents & Links for Anti ANAPC2 pAb (ATL-HPA066539) | |
| Datasheet | Anti ANAPC2 pAb (ATL-HPA066539) Datasheet (External Link) |
| Vendor Page | Anti ANAPC2 pAb (ATL-HPA066539) at Atlas |
| Documents & Links for Anti ANAPC2 pAb (ATL-HPA066539) | |
| Datasheet | Anti ANAPC2 pAb (ATL-HPA066539) Datasheet (External Link) |
| Vendor Page | Anti ANAPC2 pAb (ATL-HPA066539) |