Anti ANAPC2 pAb (ATL-HPA066539)

Atlas Antibodies

SKU:
ATL-HPA066539-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: anaphase promoting complex subunit 2
Gene Name: ANAPC2
Alternative Gene Name: APC2, KIAA1406
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026965: 95%, ENSRNOG00000011295: 95%
Entrez Gene ID: 29882
Uniprot ID: Q9UJX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REEVHTMLRGVLFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCR
Gene Sequence REEVHTMLRGVLFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCR
Gene ID - Mouse ENSMUSG00000026965
Gene ID - Rat ENSRNOG00000011295
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANAPC2 pAb (ATL-HPA066539)
Datasheet Anti ANAPC2 pAb (ATL-HPA066539) Datasheet (External Link)
Vendor Page Anti ANAPC2 pAb (ATL-HPA066539) at Atlas Antibodies

Documents & Links for Anti ANAPC2 pAb (ATL-HPA066539)
Datasheet Anti ANAPC2 pAb (ATL-HPA066539) Datasheet (External Link)
Vendor Page Anti ANAPC2 pAb (ATL-HPA066539)