Anti AMY1A pAb (ATL-HPA045394)

Atlas Antibodies

SKU: ATL-HPA045394-25

• 

Protein Description: amylase, alpha 1A (salivary)
Gene Name: AMY1A
Alternative Gene Name: AMY1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074264: 88%, ENSRNOG00000055613: 87%
Entrez Gene ID: 276
Uniprot ID: P04745
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
• Gene Sequence: SLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
• Gene ID - Mouse: ENSMUSG00000074264
• Gene ID - Rat: ENSRNOG00000055613
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AMY1A pAb (ATL-HPA045394) – 2 Found

Granlund, Louise; Hedin, Anders; Wahlhütter, Miriam; Seiron, Peter; Korsgren, Olle; Skog, Oskar; Lundberg, Marcus. Histological and transcriptional characterization of the pancreatic acinar tissue in type 1 diabetes. Bmj Open Diabetes Research & Care. 2021;9(1) 

Saitou, Marie; Gaylord, Eliza A; Xu, Erica; May, Alison J; Neznanova, Lubov; Nathan, Sara; Grawe, Anissa; Chang, Jolie; Ryan, William; Ruhl, Stefan; Knox, Sarah M; Gokcumen, Omer. Functional Specialization of Human Salivary Glands and Origins of Proteins Intrinsic to Human Saliva. Cell Reports. 2020;33(7):108402.