Anti AMT pAb (ATL-HPA005566)

Atlas Antibodies

SKU:
ATL-HPA005566-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm & mitochondria.
  • Western blot analysis in human cell line HepG2.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: aminomethyltransferase
Gene Name: AMT
Alternative Gene Name: GCST, NKH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032607: 88%, ENSRNOG00000050214: 64%
Entrez Gene ID: 275
Uniprot ID: P48728
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALL
Gene Sequence QYRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALL
Gene ID - Mouse ENSMUSG00000032607
Gene ID - Rat ENSRNOG00000050214
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AMT pAb (ATL-HPA005566)
Datasheet Anti AMT pAb (ATL-HPA005566) Datasheet (External Link)
Vendor Page Anti AMT pAb (ATL-HPA005566) at Atlas Antibodies

Documents & Links for Anti AMT pAb (ATL-HPA005566)
Datasheet Anti AMT pAb (ATL-HPA005566) Datasheet (External Link)
Vendor Page Anti AMT pAb (ATL-HPA005566)