Anti AMPD2 pAb (ATL-HPA045760 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA045760-25

• 
• 
• 

Protein Description: adenosine monophosphate deaminase 2
Gene Name: AMPD2
Alternative Gene Name: SPG63
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027889: 99%, ENSRNOG00000019240: 99%
Entrez Gene ID: 271
Uniprot ID: Q01433
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDGKCKEIAEELFTRSLAESELRSAPYEFPEESPIEQLEERRQRLERQISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGE
• Gene Sequence: MDGKCKEIAEELFTRSLAESELRSAPYEFPEESPIEQLEERRQRLERQISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGE
• Gene ID - Mouse: ENSMUSG00000027889
• Gene ID - Rat: ENSRNOG00000019240
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.