Protein Description: angiomotin
Gene Name: AMOT
Alternative Gene Name: KIAA1071
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041688: 89%, ENSRNOG00000007345: 88%
Entrez Gene ID: 154796
Uniprot ID: Q4VCS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AMOT
Alternative Gene Name: KIAA1071
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041688: 89%, ENSRNOG00000007345: 88%
Entrez Gene ID: 154796
Uniprot ID: Q4VCS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PFKGMPPQSVVCKPQEPGHFYSEHRLNQPGRTEGQLMRYQHPPEYGAARPAQDISLPLSARNSQ |
| Documents & Links for Anti AMOT pAb (ATL-HPA067853) | |
| Datasheet | Anti AMOT pAb (ATL-HPA067853) Datasheet (External Link) |
| Vendor Page | Anti AMOT pAb (ATL-HPA067853) at Atlas |
| Documents & Links for Anti AMOT pAb (ATL-HPA067853) | |
| Datasheet | Anti AMOT pAb (ATL-HPA067853) Datasheet (External Link) |
| Vendor Page | Anti AMOT pAb (ATL-HPA067853) |