Protein Description: antagonist of mitotic exit network 1 homolog
Gene Name: AMN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068250: 79%, ENSRNOG00000036917: 85%
Entrez Gene ID: 196394
Uniprot ID: Q8IY45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AMN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068250: 79%, ENSRNOG00000036917: 85%
Entrez Gene ID: 196394
Uniprot ID: Q8IY45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLVGPNKLKQVTWTVY |
Documents & Links for Anti AMN1 pAb (ATL-HPA062290) | |
Datasheet | Anti AMN1 pAb (ATL-HPA062290) Datasheet (External Link) |
Vendor Page | Anti AMN1 pAb (ATL-HPA062290) at Atlas |
Documents & Links for Anti AMN1 pAb (ATL-HPA062290) | |
Datasheet | Anti AMN1 pAb (ATL-HPA062290) Datasheet (External Link) |
Vendor Page | Anti AMN1 pAb (ATL-HPA062290) |