Anti AMIGO2 pAb (ATL-HPA054004)

Atlas Antibodies

SKU: ATL-HPA054004-25

• 
• 

Protein Description: adhesion molecule with Ig-like domain 2
Gene Name: AMIGO2
Alternative Gene Name: ALI1, DEGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048218: 85%, ENSRNOG00000007032: 82%
Entrez Gene ID: 347902
Uniprot ID: Q86SJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFYVFHNGSLVIESPRFEDAGVYSCIAMNKQRLLNETVDVTINVSNFTVSRS
• Gene Sequence: AQVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFYVFHNGSLVIESPRFEDAGVYSCIAMNKQRLLNETVDVTINVSNFTVSRS
• Gene ID - Mouse: ENSMUSG00000048218
• Gene ID - Rat: ENSRNOG00000007032
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AMIGO2 pAb (ATL-HPA054004) – 2 Found

Yi, Yuyin; Zhu, Hua; Klausen, Christian; Chang, Hsun-Ming; Inkster, Amy M; Terry, Jefferson; Leung, Peter C K. Dysregulated BMP2 in the Placenta May Contribute to Early-Onset Preeclampsia by Regulating Human Trophoblast Expression of Extracellular Matrix and Adhesion Molecules. Frontiers In Cell And Developmental Biology. 9( 34970543):768669. 

Goto, Keisuke; Osaki, Mitsuhiko; Izutsu, Runa; Tanaka, Hiroshi; Sasaki, Ryo; Tanio, Akimitsu; Satofuka, Hiroyuki; Kazuki, Yasuhiro; Yamamoto, Manabu; Kugoh, Hiroyuki; Ito, Hisao; Oshimura, Mitsuo; Fujiwara, Yoshiyuki; Okada, Futoshi. Establishment of an antibody specific for AMIGO2 improves immunohistochemical evaluation of liver metastases and clinical outcomes in patients with colorectal cancer. Diagnostic Pathology. 2022;17(1):16.