Anti AMIGO1 pAb (ATL-HPA046152)

Atlas Antibodies

SKU: ATL-HPA046152-100

• 
• 
• 

Protein Description: adhesion molecule with Ig-like domain 1
Gene Name: AMIGO1
Alternative Gene Name: AMIGO, KIAA1163
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050947: 76%, ENSRNOG00000045665: 81%
Entrez Gene ID: 57463
Uniprot ID: Q86WK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKVWVTPSNERVLDEVTNGTVSVSKDG
• Gene Sequence: SSVMDFQEDLYCMNSKKLHNVFNLSFLNCGEYKERAWEAHLGDTLIIKCDTKQQGMTKVWVTPSNERVLDEVTNGTVSVSKDG
• Gene ID - Mouse: ENSMUSG00000050947
• Gene ID - Rat: ENSRNOG00000045665
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.