Protein Description: anti-Mullerian hormone
Gene Name: AMH
Alternative Gene Name: MIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035262: 66%, ENSRNOG00000019377: 67%
Entrez Gene ID: 268
Uniprot ID: P03971
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AMH
Alternative Gene Name: MIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035262: 66%, ENSRNOG00000019377: 67%
Entrez Gene ID: 268
Uniprot ID: P03971
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GEDSRLSTARLQALLFGDDHRCFTRMTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAELEESPPSADPFLETLT |
| Documents & Links for Anti AMH pAb (ATL-HPA066973) | |
| Datasheet | Anti AMH pAb (ATL-HPA066973) Datasheet (External Link) |
| Vendor Page | Anti AMH pAb (ATL-HPA066973) at Atlas |
| Documents & Links for Anti AMH pAb (ATL-HPA066973) | |
| Datasheet | Anti AMH pAb (ATL-HPA066973) Datasheet (External Link) |
| Vendor Page | Anti AMH pAb (ATL-HPA066973) |