Anti AMER3 pAb (ATL-HPA054230)

Atlas Antibodies

SKU: ATL-HPA054230-25

• 

Protein Description: APC membrane recruitment protein 3
Gene Name: AMER3
Alternative Gene Name: FAM123C, FLJ38377
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045174: 83%, ENSRNOG00000023603: 86%
Entrez Gene ID: 205147
Uniprot ID: Q8N944
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDFTRFWDSVNRSVRQQQRALLGPWLSGPQGTDRDQPRLDTAGLAELPLCPCRDPRSGSKASSIDTGTPKSEQPESVSTS
• Gene Sequence: SDFTRFWDSVNRSVRQQQRALLGPWLSGPQGTDRDQPRLDTAGLAELPLCPCRDPRSGSKASSIDTGTPKSEQPESVSTS
• Gene ID - Mouse: ENSMUSG00000045174
• Gene ID - Rat: ENSRNOG00000023603
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.