Anti AMER3 pAb (ATL-HPA045593)

Atlas Antibodies

SKU:
ATL-HPA045593-25
  • Immunohistochemical staining of human stomach, lower shows strong cytoplasmic and nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to nuclear bodies.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: APC membrane recruitment protein 3
Gene Name: AMER3
Alternative Gene Name: FAM123C, FLJ38377
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045174: 31%, ENSRNOG00000023603: 31%
Entrez Gene ID: 205147
Uniprot ID: Q8N944
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YSASTQDQRCRDRVQDLSWLRVEPTGLGVQAWASVEDQPLQLSTEAVEQVAHGSQLDSEPRSAPAARWSSQGHHPESLGLTLNSQQEGGVSASAPEC
Gene Sequence YSASTQDQRCRDRVQDLSWLRVEPTGLGVQAWASVEDQPLQLSTEAVEQVAHGSQLDSEPRSAPAARWSSQGHHPESLGLTLNSQQEGGVSASAPEC
Gene ID - Mouse ENSMUSG00000045174
Gene ID - Rat ENSRNOG00000023603
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AMER3 pAb (ATL-HPA045593)
Datasheet Anti AMER3 pAb (ATL-HPA045593) Datasheet (External Link)
Vendor Page Anti AMER3 pAb (ATL-HPA045593) at Atlas Antibodies

Documents & Links for Anti AMER3 pAb (ATL-HPA045593)
Datasheet Anti AMER3 pAb (ATL-HPA045593) Datasheet (External Link)
Vendor Page Anti AMER3 pAb (ATL-HPA045593)