Protein Description: APC membrane recruitment protein 1
Gene Name: AMER1
Alternative Gene Name: FAM123B, FLJ39827, RP11-403E24.2, WTX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050332: 69%, ENSRNOG00000007984: 69%
Entrez Gene ID: 139285
Uniprot ID: Q5JTC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AMER1
Alternative Gene Name: FAM123B, FLJ39827, RP11-403E24.2, WTX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050332: 69%, ENSRNOG00000007984: 69%
Entrez Gene ID: 139285
Uniprot ID: Q5JTC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RDSPLSLYTEPPGAYDWPAWAPCPLPVGPGPAWISPNQLDRPSSQSPYRQATCCIPPMTMSISLSVPESRAPGESGPQLARPSHLHLP |
| Documents & Links for Anti AMER1 pAb (ATL-HPA065214) | |
| Datasheet | Anti AMER1 pAb (ATL-HPA065214) Datasheet (External Link) |
| Vendor Page | Anti AMER1 pAb (ATL-HPA065214) at Atlas |
| Documents & Links for Anti AMER1 pAb (ATL-HPA065214) | |
| Datasheet | Anti AMER1 pAb (ATL-HPA065214) Datasheet (External Link) |
| Vendor Page | Anti AMER1 pAb (ATL-HPA065214) |