Anti ALS2 pAb (ATL-HPA046588)
Atlas Antibodies
- SKU:
- ATL-HPA046588-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ALS2
Alternative Gene Name: ALS2CR6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026024: 91%, ENSRNOG00000023280: 91%
Entrez Gene ID: 57679
Uniprot ID: Q96Q42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FQPGLYYSGRQDPTEGDNLPENHSGSKTPVLLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSD |
Gene Sequence | FQPGLYYSGRQDPTEGDNLPENHSGSKTPVLLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSD |
Gene ID - Mouse | ENSMUSG00000026024 |
Gene ID - Rat | ENSRNOG00000023280 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALS2 pAb (ATL-HPA046588) | |
Datasheet | Anti ALS2 pAb (ATL-HPA046588) Datasheet (External Link) |
Vendor Page | Anti ALS2 pAb (ATL-HPA046588) at Atlas Antibodies |
Documents & Links for Anti ALS2 pAb (ATL-HPA046588) | |
Datasheet | Anti ALS2 pAb (ATL-HPA046588) Datasheet (External Link) |
Vendor Page | Anti ALS2 pAb (ATL-HPA046588) |