Anti ALS2 pAb (ATL-HPA046588)

Atlas Antibodies

SKU:
ATL-HPA046588-25
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: amyotrophic lateral sclerosis 2 (juvenile)
Gene Name: ALS2
Alternative Gene Name: ALS2CR6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026024: 91%, ENSRNOG00000023280: 91%
Entrez Gene ID: 57679
Uniprot ID: Q96Q42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FQPGLYYSGRQDPTEGDNLPENHSGSKTPVLLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSD
Gene Sequence FQPGLYYSGRQDPTEGDNLPENHSGSKTPVLLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSD
Gene ID - Mouse ENSMUSG00000026024
Gene ID - Rat ENSRNOG00000023280
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ALS2 pAb (ATL-HPA046588)
Datasheet Anti ALS2 pAb (ATL-HPA046588) Datasheet (External Link)
Vendor Page Anti ALS2 pAb (ATL-HPA046588) at Atlas Antibodies

Documents & Links for Anti ALS2 pAb (ATL-HPA046588)
Datasheet Anti ALS2 pAb (ATL-HPA046588) Datasheet (External Link)
Vendor Page Anti ALS2 pAb (ATL-HPA046588)