Anti ALKBH2 pAb (ATL-HPA045392)

Atlas Antibodies

SKU:
ATL-HPA045392-25
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase
Gene Name: ALKBH2
Alternative Gene Name: ABH2, MGC90512
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044339: 89%, ENSRNOG00000028584: 88%
Entrez Gene ID: 121642
Uniprot ID: Q6NS38
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRK
Gene Sequence DDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRK
Gene ID - Mouse ENSMUSG00000044339
Gene ID - Rat ENSRNOG00000028584
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ALKBH2 pAb (ATL-HPA045392)
Datasheet Anti ALKBH2 pAb (ATL-HPA045392) Datasheet (External Link)
Vendor Page Anti ALKBH2 pAb (ATL-HPA045392) at Atlas Antibodies

Documents & Links for Anti ALKBH2 pAb (ATL-HPA045392)
Datasheet Anti ALKBH2 pAb (ATL-HPA045392) Datasheet (External Link)
Vendor Page Anti ALKBH2 pAb (ATL-HPA045392)