Anti ALG3 pAb (ATL-HPA045103)

Atlas Antibodies

SKU: ATL-HPA045103-25

• 

Protein Description: ALG3, alpha-1,3- mannosyltransferase
Gene Name: ALG3
Alternative Gene Name: CDGS4, D16Ertd36e, Not56, NOT56L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033809: 87%, ENSRNOG00000001712: 89%
Entrez Gene ID: 10195
Uniprot ID: Q92685
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIR
• Gene Sequence: IDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIR
• Gene ID - Mouse: ENSMUSG00000033809
• Gene ID - Rat: ENSRNOG00000001712
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.