Anti ALG1 pAb (ATL-HPA060392)

Atlas Antibodies

SKU:
ATL-HPA060392-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts, Leydig cells shows moderate staining.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoli fibrillar center & endoplasmic reticulum.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase
Gene Name: ALG1
Alternative Gene Name: HMAT1, HMT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039427: 71%, ENSRNOG00000002883: 72%
Entrez Gene ID: 56052
Uniprot ID: Q9BT22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NWHIRAVTVYDKPASFFKETPLDLQHRLFMKLGSMHSPFRARSEPEDPVTERSAFTERDAGSGLVTRLRERP
Gene Sequence NWHIRAVTVYDKPASFFKETPLDLQHRLFMKLGSMHSPFRARSEPEDPVTERSAFTERDAGSGLVTRLRERP
Gene ID - Mouse ENSMUSG00000039427
Gene ID - Rat ENSRNOG00000002883
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ALG1 pAb (ATL-HPA060392)
Datasheet Anti ALG1 pAb (ATL-HPA060392) Datasheet (External Link)
Vendor Page Anti ALG1 pAb (ATL-HPA060392) at Atlas Antibodies

Documents & Links for Anti ALG1 pAb (ATL-HPA060392)
Datasheet Anti ALG1 pAb (ATL-HPA060392) Datasheet (External Link)
Vendor Page Anti ALG1 pAb (ATL-HPA060392)