Anti ALDH8A1 pAb (ATL-HPA055414 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055414-25

• 
• 

Protein Description: aldehyde dehydrogenase 8 family, member A1
Gene Name: ALDH8A1
Alternative Gene Name: ALDH12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037542: 88%, ENSRNOG00000014907: 89%
Entrez Gene ID: 64577
Uniprot ID: Q9H2A2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEGAQIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLAATVWSSNVGRVHRVAKKLQSGLVW
• Gene Sequence: AEGAQIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLAATVWSSNVGRVHRVAKKLQSGLVW
• Gene ID - Mouse: ENSMUSG00000037542
• Gene ID - Rat: ENSRNOG00000014907
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.