Anti ALDH7A1 pAb (ATL-HPA053675 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA053675-100

• 
• 

Protein Description: aldehyde dehydrogenase 7 family member A1
Gene Name: ALDH7A1
Alternative Gene Name: ATQ1, EPD, PDE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053644: 99%, ENSRNOG00000014645: 99%
Entrez Gene ID: 501
Uniprot ID: P49419
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINY
• Gene Sequence: EVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINY
• Gene ID - Mouse: ENSMUSG00000053644
• Gene ID - Rat: ENSRNOG00000014645
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.