Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA045132-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ALDH3B2
Alternative Gene Name: ALDH8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037263: 62%, ENSRNOG00000017872: 68%
Entrez Gene ID: 222
Uniprot ID: P48448
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL |
Gene Sequence | SGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL |
Gene ID - Mouse | ENSMUSG00000037263 |
Gene ID - Rat | ENSRNOG00000017872 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) | |
Datasheet | Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) | |
Datasheet | Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) |
Citations for Anti ALDH3B2 pAb (ATL-HPA045132 w/enhanced validation) – 1 Found |
Han, Guanghui; Zhen, Weizhe; Dai, Yuan; Yu, Hongni; Li, Dongyue; Ma, Tao. Dihuang-Yinzi Alleviates Cognition Deficits via Targeting Energy-Related Metabolism in an Alzheimer Mouse Model as Demonstrated by Integration of Metabolomics and Network Pharmacology. Frontiers In Aging Neuroscience. 14( 35431901):873929. PubMed |