Anti AKTIP pAb (ATL-HPA046300)

Atlas Antibodies

SKU: ATL-HPA046300-25

• 
• 

Protein Description: AKT interacting protein
Gene Name: AKTIP
Alternative Gene Name: FLJ13258, FTS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031667: 99%, ENSRNOG00000011956: 99%
Entrez Gene ID: 64400
Uniprot ID: Q9H8T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNPEAAVLYEKDIQLFKSKVVDSVKVCTARLFDQPKIEDPYAISFSPWNPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEK
• Gene Sequence: LNPEAAVLYEKDIQLFKSKVVDSVKVCTARLFDQPKIEDPYAISFSPWNPSVHDEAREKMLTQKKPEEQHNKSVHVAGLSWVKPGSVQPFSKEEK
• Gene ID - Mouse: ENSMUSG00000031667
• Gene ID - Rat: ENSRNOG00000011956
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AKTIP pAb (ATL-HPA046300) – 1 Found

Feng, Zhen; Yu, Cheng-Han. PI(3,4)P(2)-mediated membrane tubulation promotes integrin trafficking and invasive cell migration. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(19)