Anti AKT2 pAb (ATL-HPA064521)

Atlas Antibodies

SKU: ATL-HPA064521-25

• 
• 

Protein Description: v-akt murine thymoma viral oncogene homolog 2
Gene Name: AKT2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004056: 92%, ENSRNOG00000018677: 92%
Entrez Gene ID: 208
Uniprot ID: P31751
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMND
• Gene Sequence: HVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMND
• Gene ID - Mouse: ENSMUSG00000004056
• Gene ID - Rat: ENSRNOG00000018677
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AKT2 pAb (ATL-HPA064521) – 1 Found

Zhou, Kun; Chen, Qiaoli; Chen, Jiamou; Liang, Derong; Feng, Weikuan; Liu, Minjun; Wang, Qi; Wang, Ruizhen; Ouyang, Qian; Quan, Chao; Chen, Shuai. Spatiotemporal regulation of insulin signaling by liquid-liquid phase separation. Cell Discovery. 2022;8(1):64.