Protein Description: AKT1 substrate 1 (proline-rich)
Gene Name: AKT1S1
Alternative Gene Name: Lobe, MGC2865, PRAS40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011096: 99%, ENSRNOG00000020289: 97%
Entrez Gene ID: 84335
Uniprot ID: Q96B36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AKT1S1
Alternative Gene Name: Lobe, MGC2865, PRAS40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011096: 99%, ENSRNOG00000020289: 97%
Entrez Gene ID: 84335
Uniprot ID: Q96B36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRK |
Documents & Links for Anti AKT1S1 pAb (ATL-HPA064427) | |
Datasheet | Anti AKT1S1 pAb (ATL-HPA064427) Datasheet (External Link) |
Vendor Page | Anti AKT1S1 pAb (ATL-HPA064427) at Atlas |
Documents & Links for Anti AKT1S1 pAb (ATL-HPA064427) | |
Datasheet | Anti AKT1S1 pAb (ATL-HPA064427) Datasheet (External Link) |
Vendor Page | Anti AKT1S1 pAb (ATL-HPA064427) |