Anti AKIRIN1 pAb (ATL-HPA051871)

Atlas Antibodies

SKU:
ATL-HPA051871-25
  • Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: akirin 1
Gene Name: AKIRIN1
Alternative Gene Name: C1orf108, FLJ12666
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023075: 88%, ENSRNOG00000026610: 89%
Entrez Gene ID: 79647
Uniprot ID: Q9H9L7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQPTFT
Gene Sequence RRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQPTFT
Gene ID - Mouse ENSMUSG00000023075
Gene ID - Rat ENSRNOG00000026610
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AKIRIN1 pAb (ATL-HPA051871)
Datasheet Anti AKIRIN1 pAb (ATL-HPA051871) Datasheet (External Link)
Vendor Page Anti AKIRIN1 pAb (ATL-HPA051871) at Atlas Antibodies

Documents & Links for Anti AKIRIN1 pAb (ATL-HPA051871)
Datasheet Anti AKIRIN1 pAb (ATL-HPA051871) Datasheet (External Link)
Vendor Page Anti AKIRIN1 pAb (ATL-HPA051871)