Anti AKIP1 pAb (ATL-HPA061391)

Atlas Antibodies

SKU: ATL-HPA061391-25

• 

Product Description

Protein Description: A kinase (PRKA) interacting protein 1
Gene Name: AKIP1
Alternative Gene Name: BCA3, C11orf17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031023: 63%, ENSRNOG00000013744: 63%
Entrez Gene ID: 56672
Uniprot ID: Q9NQ31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLEKQPAAGPQRVLPGE
• Gene Sequence: VDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLEKQPAAGPQRVLPGE
• Gene ID - Mouse: ENSMUSG00000031023
• Gene ID - Rat: ENSRNOG00000013744
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links