Anti AKAP14 pAb (ATL-HPA060999 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA060999-25

• 

Product Description

Protein Description: A kinase (PRKA) anchor protein 14
Gene Name: AKAP14
Alternative Gene Name: AKAP28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028573: 29%, ENSRNOG00000008907: 29%
Entrez Gene ID: 158798
Uniprot ID: Q86UN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SETQNSTSQKAMDEDNKAASQTMPNTQDKNYEDELTQVALALVEDVINYAV
• Gene Sequence: SETQNSTSQKAMDEDNKAASQTMPNTQDKNYEDELTQVALALVEDVINYAV
• Gene ID - Mouse: ENSMUSG00000028573
• Gene ID - Rat: ENSRNOG00000008907
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links